Lineage for d1dwki1 (1dwk I:1-86)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47323Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 47324Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 47395Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
  6. 47396Protein Cyanase N-terminal domain [47436] (1 species)
  7. 47397Species Escherichia coli [TaxId:562] [47437] (2 PDB entries)
  8. 47416Domain d1dwki1: 1dwk I:1-86 [17083]
    Other proteins in same PDB: d1dwka2, d1dwkb2, d1dwkc2, d1dwkd2, d1dwke2, d1dwkf2, d1dwkg2, d1dwkh2, d1dwki2, d1dwkj2

Details for d1dwki1

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site

SCOP Domain Sequences for d1dwki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwki1 a.35.1.4 (I:1-86) Cyanase N-terminal domain {Escherichia coli}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOP Domain Coordinates for d1dwki1:

Click to download the PDB-style file with coordinates for d1dwki1.
(The format of our PDB-style files is described here.)

Timeline for d1dwki1: