Lineage for d2yj1a1 (2yj1 A:1-202)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250926Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2250927Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2251061Protein automated matches [190236] (4 species)
    not a true protein
  7. 2251062Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries)
  8. 2251090Domain d2yj1a1: 2yj1 A:1-202 [170824]
    Other proteins in same PDB: d2yj1a2
    automated match to d1g5ja_

Details for d2yj1a1

PDB Entry: 2yj1 (more details), 2.24 Å

PDB Description: puma bh3 foldamer in complex with bcl-xl
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d2yj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yj1a1 f.1.4.1 (A:1-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaae

SCOPe Domain Coordinates for d2yj1a1:

Click to download the PDB-style file with coordinates for d2yj1a1.
(The format of our PDB-style files is described here.)

Timeline for d2yj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yj1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2yj1c_