Lineage for d2yj1a_ (2yj1 A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955392Protein automated matches [190236] (3 species)
    not a true protein
  7. 1955393Species Human (Homo sapiens) [TaxId:9606] [188722] (38 PDB entries)
  8. 1955422Domain d2yj1a_: 2yj1 A: [170824]
    automated match to d1g5ja_

Details for d2yj1a_

PDB Entry: 2yj1 (more details), 2.24 Å

PDB Description: puma bh3 foldamer in complex with bcl-xl
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d2yj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yj1a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsq
lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawma
tylndhlepwiqenggwdtfvelygnnaaae

SCOPe Domain Coordinates for d2yj1a_:

Click to download the PDB-style file with coordinates for d2yj1a_.
(The format of our PDB-style files is described here.)

Timeline for d2yj1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yj1c_