SCOPe 2.01: Domain d2yj1a_: 2yj1 A:

Lineage for d2yj1a_ (2yj1 A:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (14 PDB entries)

8. Domain d2yj1a_: 2yj1 A: [170824]
   automated match to d1g5ja_

Details for d2yj1a_

PDB Entry: 2yj1, 2.24 Å

PDB Description: puma bh3 foldamer in complex with bcl-xl

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d2yj1a_:

Sequence; same for both SEQRES and ATOM records:

>d2yj1a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsq
lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawma
tylndhlepwiqenggwdtfvelygnnaaae

Timeline for d2yj1a_:

• d2yj1a_ is new in SCOPe 2.01-stable
  
• d2yj1a_ appears in SCOPe 2.02
  
• d2yj1a_ appears in the current release, SCOPe 2.08, called d2yj1a1