Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.0: automated matches [191578] (1 protein) not a true family |
Protein automated matches [191015] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189757] (2 PDB entries) |
Domain d2yj0f_: 2yj0 F: [170823] automated match to d2cz8b1 complexed with 420, cl, coa, fmn, so4 |
PDB Entry: 2yj0 (more details), 2.4 Å
SCOPe Domain Sequences for d2yj0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yj0f_ d.230.2.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} snhtyrvieivgtspdgvdaaiqgglaraaqtmraldwfevqsirghlvdgavahfqvcm kvgfrled
Timeline for d2yj0f_: