Lineage for d2yizd_ (2yiz D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008137Family d.230.2.0: automated matches [191578] (1 protein)
    not a true family
  6. 3008138Protein automated matches [191015] (5 species)
    not a true protein
  7. 3008169Species Mycobacterium tuberculosis [TaxId:83332] [189757] (2 PDB entries)
  8. 3008173Domain d2yizd_: 2yiz D: [170817]
    automated match to d2cz8a1
    complexed with cl, coa, fmn, gol, trs

Details for d2yizd_

PDB Entry: 2yiz (more details), 1.7 Å

PDB Description: x-ray structure of mycobacterium tuberculosis dodecin
PDB Compounds: (D:) dodecin

SCOPe Domain Sequences for d2yizd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yizd_ d.230.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
snhtyrvieivgtspdgvdaaiqgglaraaqtmraldwfevqsirghlvdgavahfqvtm
kvgfrled

SCOPe Domain Coordinates for d2yizd_:

Click to download the PDB-style file with coordinates for d2yizd_.
(The format of our PDB-style files is described here.)

Timeline for d2yizd_: