Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
Domain d2yixa_: 2yix A: [170813] automated match to d1a9ua_ complexed with yix |
PDB Entry: 2yix (more details), 2.3 Å
SCOPe Domain Sequences for d2yixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yixa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
Timeline for d2yixa_: