Lineage for d2yhda_ (2yhd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2335125Protein Androgen receptor [63621] (4 species)
  7. 2335135Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2335169Domain d2yhda_: 2yhd A: [170786]
    automated match to d1xowa_
    complexed with av6, so4, tes

Details for d2yhda_

PDB Entry: 2yhd (more details), 2.2 Å

PDB Description: human androgen receptor in complex with af2 small molecule inhibitor
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2yhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhda_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfhtq

SCOPe Domain Coordinates for d2yhda_:

Click to download the PDB-style file with coordinates for d2yhda_.
(The format of our PDB-style files is described here.)

Timeline for d2yhda_: