![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (3 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries) |
![]() | Domain d2yfjh_: 2yfj H: [170778] automated match to d1wqlb1 complexed with 1it, fe2, fes |
PDB Entry: 2yfj (more details), 2.15 Å
SCOPe Domain Sequences for d2yfjh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfjh_ d.17.4.4 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]} fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2yfjh_: