Lineage for d2yfjb_ (2yfj B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543749Protein automated matches [190223] (5 species)
    not a true protein
  7. 2543750Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2543757Domain d2yfjb_: 2yfj B: [170775]
    Other proteins in same PDB: d2yfja1, d2yfja2, d2yfjc1, d2yfjc2, d2yfje1, d2yfje2, d2yfjg1, d2yfjg2, d2yfji1, d2yfji2, d2yfjk1, d2yfjk2
    automated match to d1wqlb1
    complexed with 1it, fe2, fes

Details for d2yfjb_

PDB Entry: 2yfj (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
PDB Compounds: (B:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2yfjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfjb_ d.17.4.4 (B:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2yfjb_:

Click to download the PDB-style file with coordinates for d2yfjb_.
(The format of our PDB-style files is described here.)

Timeline for d2yfjb_: