| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
| Protein automated matches [190223] (5 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
| Domain d2yfih_: 2yfi H: [170772] Other proteins in same PDB: d2yfia1, d2yfia2, d2yfic1, d2yfic2, d2yfie1, d2yfie2, d2yfig1, d2yfig2, d2yfii1, d2yfii2, d2yfik1, d2yfik2 automated match to d1wqlb1 complexed with fe2, fes |
PDB Entry: 2yfi (more details), 2.15 Å
SCOPe Domain Sequences for d2yfih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfih_ d.17.4.4 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2yfih_: