Lineage for d2yfid_ (2yfi D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936665Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2936667Domain d2yfid_: 2yfi D: [170770]
    Other proteins in same PDB: d2yfia1, d2yfia2, d2yfic1, d2yfic2, d2yfie1, d2yfie2, d2yfig1, d2yfig2, d2yfii1, d2yfii2, d2yfik1, d2yfik2
    automated match to d1wqlb1
    complexed with fe2, fes

Details for d2yfid_

PDB Entry: 2yfi (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 (bpdo-rr41)
PDB Compounds: (D:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2yfid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfid_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2yfid_:

Click to download the PDB-style file with coordinates for d2yfid_.
(The format of our PDB-style files is described here.)

Timeline for d2yfid_: