Lineage for d2ycpc_ (2ycp C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380255Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 1380278Protein automated matches [190632] (1 species)
    not a true protein
  7. 1380279Species Citrobacter freundii [TaxId:546] [187681] (8 PDB entries)
  8. 1380286Domain d2ycpc_: 2ycp C: [170758]
    automated match to d1c7ga_
    complexed with 1pe, edo, k, p33, p61, peg, pg4, pge; mutant

Details for d2ycpc_

PDB Entry: 2ycp (more details), 2 Å

PDB Description: f448h mutant of tyrosine phenol-lyase from citrobacter freundii in complex with quinonoid intermediate formed with 3-fluoro-l-tyrosine
PDB Compounds: (C:) tyrosine phenol-lyase

SCOPe Domain Sequences for d2ycpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycpc_ c.67.1.2 (C:) automated matches {Citrobacter freundii [TaxId: 546]}
mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
adgiiklyqhkedirglkfiyepkqlrhftarfdyi

SCOPe Domain Coordinates for d2ycpc_:

Click to download the PDB-style file with coordinates for d2ycpc_.
(The format of our PDB-style files is described here.)

Timeline for d2ycpc_: