Lineage for d2ycnb_ (2ycn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895601Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 2895666Protein automated matches [190632] (1 species)
    not a true protein
  7. 2895667Species Citrobacter freundii [TaxId:546] [187681] (6 PDB entries)
  8. 2895679Domain d2ycnb_: 2ycn B: [170755]
    automated match to d1c7ga_
    complexed with k, p61, peg, pg4; mutant

Details for d2ycnb_

PDB Entry: 2ycn (more details), 2.04 Å

PDB Description: y71f mutant of tyrosine phenol-lyase from citrobacter freundii in complex with quinonoid intermediate formed with 3-fluoro-l-tyrosine
PDB Compounds: (B:) tyrosine phenol-lyase

SCOPe Domain Sequences for d2ycnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycnb_ c.67.1.2 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
wagmmmgdeafagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
adgiiklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d2ycnb_:

Click to download the PDB-style file with coordinates for d2ycnb_.
(The format of our PDB-style files is described here.)

Timeline for d2ycnb_: