SCOPe 2.08: Domain d2yckx1: 2yck X:1-263

Lineage for d2yckx1 (2yck X:1-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)

6. Protein automated matches [190620] (2 species)
   not a true protein

7. Species Carboxydothermus hydrogenoformans [TaxId:246194] [189987] (3 PDB entries)

8. Domain d2yckx1: 2yck X:1-263 [170753]
   Other proteins in same PDB: d2yckx2
   automated match to d1f6ya_
   complexed with gol, so4, thg

Details for d2yckx1

PDB Entry: 2yck, 2.15 Å

PDB Description: methyltransferase bound with tetrahydrofolate

PDB Compounds: (X:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2yckx1:

Sequence; same for both SEQRES and ATOM records:

>d2yckx1 c.1.21.2 (X:1-263) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]}
mfimigeringmfkdireailnkdprpiqewarrqaekgahyldvntgptaddpvrvmew
lvktiqevvdlpccldstnpdaieaglkvhrghaminstsadqwkmdiffpmakkyeaai
igltmnekgvpkdandrsqlamelvanadahgipmtelyidplilpvnvaqehavevlet
irqiklmanpaprtvlglsnvsqkcpdrplinrtylvmamtagldaaimdvdddalvdaa
atahillnkeiycdsylktfrqk

Timeline for d2yckx1:

• d2yckx1 first appeared in SCOPe 2.01, called d2yckx_
  
• d2yckx1 appears in SCOPe 2.07