Lineage for d2ycja_ (2ycj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1826089Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1826184Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 1826207Protein automated matches [190620] (2 species)
    not a true protein
  7. 1826208Species Carboxydothermus hydrogenoformans [TaxId:246194] [189987] (3 PDB entries)
  8. 1826210Domain d2ycja_: 2ycj A: [170752]
    automated match to d1f6ya_
    complexed with c2f, gol, so4

Details for d2ycja_

PDB Entry: 2ycj (more details), 1.96 Å

PDB Description: methyltransferase bound with methyltetrahydrofolate
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2ycja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycja_ c.1.21.2 (A:) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]}
glvprgshmfimigeringmfkdireailnkdprpiqewarrqaekgahyldvntgptad
dpvrvmewlvktiqevvdlpccldstnpdaieaglkvhrghaminstsadqwkmdiffpm
akkyeaaiigltmnekgvpkdandrsqlamelvanadahgipmtelyidplilpvnvaqe
havevletirqiklmanpaprtvlglsnvsqkcpdrplinrtylvmamtagldaaimdvd
ddalvdaaatahillnkeiycdsylktfrqk

SCOPe Domain Coordinates for d2ycja_:

Click to download the PDB-style file with coordinates for d2ycja_.
(The format of our PDB-style files is described here.)

Timeline for d2ycja_: