Lineage for d2ycja1 (2ycj A:1-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840322Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2840464Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 2840487Protein automated matches [190620] (2 species)
    not a true protein
  7. 2840488Species Carboxydothermus hydrogenoformans [TaxId:246194] [189987] (3 PDB entries)
  8. 2840490Domain d2ycja1: 2ycj A:1-263 [170752]
    Other proteins in same PDB: d2ycja2
    automated match to d1f6ya_
    complexed with c2f, gol, so4

Details for d2ycja1

PDB Entry: 2ycj (more details), 1.96 Å

PDB Description: methyltransferase bound with methyltetrahydrofolate
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2ycja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycja1 c.1.21.2 (A:1-263) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]}
mfimigeringmfkdireailnkdprpiqewarrqaekgahyldvntgptaddpvrvmew
lvktiqevvdlpccldstnpdaieaglkvhrghaminstsadqwkmdiffpmakkyeaai
igltmnekgvpkdandrsqlamelvanadahgipmtelyidplilpvnvaqehavevlet
irqiklmanpaprtvlglsnvsqkcpdrplinrtylvmamtagldaaimdvdddalvdaa
atahillnkeiycdsylktfrqk

SCOPe Domain Coordinates for d2ycja1:

Click to download the PDB-style file with coordinates for d2ycja1.
(The format of our PDB-style files is described here.)

Timeline for d2ycja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ycja2