Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins) |
Protein automated matches [190620] (2 species) not a true protein |
Species Carboxydothermus hydrogenoformans [TaxId:246194] [189987] (3 PDB entries) |
Domain d2ycja1: 2ycj A:1-263 [170752] Other proteins in same PDB: d2ycja2 automated match to d1f6ya_ complexed with c2f, gol, so4 |
PDB Entry: 2ycj (more details), 1.96 Å
SCOPe Domain Sequences for d2ycja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ycja1 c.1.21.2 (A:1-263) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]} mfimigeringmfkdireailnkdprpiqewarrqaekgahyldvntgptaddpvrvmew lvktiqevvdlpccldstnpdaieaglkvhrghaminstsadqwkmdiffpmakkyeaai igltmnekgvpkdandrsqlamelvanadahgipmtelyidplilpvnvaqehavevlet irqiklmanpaprtvlglsnvsqkcpdrplinrtylvmamtagldaaimdvdddalvdaa atahillnkeiycdsylktfrqk
Timeline for d2ycja1: