SCOPe 2.01: Domain d2ycga_: 2ycg A:

Lineage for d2ycga_ (2ycg A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (131 PDB entries)
   Uniprot P00431

8. Domain d2ycga_: 2ycg A: [170750]
   automated match to d1koka_
   complexed with hem, mpd, po4

Details for d2ycga_

PDB Entry: 2ycg, 1.81 Å

PDB Description: structure of unreduced ferric cytochrome c peroxidase obtained by multicrystal method

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2ycga_:

Sequence; same for both SEQRES and ATOM records:

>d2ycga_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2ycga_:

• d2ycga_ is new in SCOPe 2.01-stable
  
• d2ycga_ appears in SCOPe 2.02
  
• d2ycga_ appears in the current release, SCOPe 2.08