SCOP 1.73: Domain d1dw9j1: 1dw9 J:1-86

Lineage for d1dw9j1 (1dw9 J:1-86)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
   probably does not bind to DNA

6. Protein Cyanase N-terminal domain [47436] (1 species)

7. Species Escherichia coli [TaxId:562] [47437] (4 PDB entries)

8. Domain d1dw9j1: 1dw9 J:1-86 [17074]
   Other proteins in same PDB: d1dw9a2, d1dw9b2, d1dw9c2, d1dw9d2, d1dw9e2, d1dw9f2, d1dw9g2, d1dw9h2, d1dw9i2, d1dw9j2
   CASP3
   complexed with cl, so4

Details for d1dw9j1

PDB Entry: 1dw9, 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site

PDB Compounds: (J:) cyanate lyase

SCOP Domain Sequences for d1dw9j1:

Sequence; same for both SEQRES and ATOM records:

>d1dw9j1 a.35.1.4 (J:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

Timeline for d1dw9j1:

• d1dw9j1 first appeared (with stable ids) in SCOP 1.55
  
• d1dw9j1 appears in SCOP 1.71
  
• d1dw9j1 appears in SCOP 1.75
  
• d1dw9j1 appears in the current release, SCOPe 2.08