Lineage for d2yc4a_ (2yc4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775238Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [189684] (2 PDB entries)
  8. 2775241Domain d2yc4a_: 2yc4 A: [170738]
    Other proteins in same PDB: d2yc4c_, d2yc4d_
    automated match to d1tvga_
    complexed with ca, cl, mg

Details for d2yc4a_

PDB Entry: 2yc4 (more details), 2.8 Å

PDB Description: intraflagellar transport complex 25-27 from chlamydomonas
PDB Compounds: (A:) intraflagellar transport protein 25

SCOPe Domain Sequences for d2yc4a_:

Sequence, based on SEQRES records: (download)

>d2yc4a_ b.18.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mkdyareengglvvmascsderfppenmldgkdntfwvttgmfpqefvlrlescirvski
ttlslnvrklavekcdqdkpdqfekvfevelanrgdrlqtevhqvnirakylkfillqgh
gefatvnrvsvvggd

Sequence, based on observed residues (ATOM records): (download)

>d2yc4a_ b.18.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mkdyareengglvvmascsderfppenmldgkdntfwvttgmfpqefvlrlescirvski
ttlslnvrklavekcdqdkpdqfekvfevelanlqtevhqvnirakylkfillqghgefa
tvnrvsvvggd

SCOPe Domain Coordinates for d2yc4a_:

Click to download the PDB-style file with coordinates for d2yc4a_.
(The format of our PDB-style files is described here.)

Timeline for d2yc4a_: