Lineage for d2yc1f_ (2yc1 F:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1700854Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1700855Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 1700871Protein Scorpion toxin [57097] (17 species)
  7. 1700918Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (3 PDB entries)
  8. 1700920Domain d2yc1f_: 2yc1 F: [170735]
    Other proteins in same PDB: d2yc1a_, d2yc1b_, d2yc1d_, d2yc1e_
    automated match to d1cn2a_
    complexed with gol

Details for d2yc1f_

PDB Entry: 2yc1 (more details), 1.9 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (F:) beta-mammal toxin cn2

SCOPe Domain Sequences for d2yc1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yc1f_ g.3.7.1 (F:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]}
kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
pnkrc

SCOPe Domain Coordinates for d2yc1f_:

Click to download the PDB-style file with coordinates for d2yc1f_.
(The format of our PDB-style files is described here.)

Timeline for d2yc1f_: