SCOPe 2.04: Domain d2yc1c_: 2yc1 C:

Lineage for d2yc1c_ (2yc1 C:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (5 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (3 PDB entries)

8. Domain d2yc1c_: 2yc1 C: [170734]
   Other proteins in same PDB: d2yc1a_, d2yc1b_, d2yc1d_, d2yc1e_
   automated match to d1cn2a_
   complexed with gol

Details for d2yc1c_

PDB Entry: 2yc1, 1.9 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann

PDB Compounds: (C:) beta-mammal toxin cn2

SCOPe Domain Sequences for d2yc1c_:

Sequence; same for both SEQRES and ATOM records:

>d2yc1c_ g.3.7.1 (C:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]}
kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
pnkrc

Timeline for d2yc1c_:

• d2yc1c_ first appeared in SCOPe 2.01
  
• d2yc1c_ appears in SCOPe 2.03
  
• d2yc1c_ appears in SCOPe 2.05
  
• d2yc1c_ appears in the current release, SCOPe 2.08