Lineage for d2ybrf_ (2ybr F:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030457Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 3030473Protein Scorpion toxin [57097] (17 species)
  7. 3030520Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (4 PDB entries)
  8. 3030524Domain d2ybrf_: 2ybr F: [170729]
    Other proteins in same PDB: d2ybra_, d2ybrb1, d2ybrb2, d2ybrd_, d2ybre1, d2ybre2, d2ybrg_, d2ybrh1, d2ybrh2
    automated match to d1cn2a_

Details for d2ybrf_

PDB Entry: 2ybr (more details), 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (F:) beta-mammal toxin cn2

SCOPe Domain Sequences for d2ybrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybrf_ g.3.7.1 (F:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]}
kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
pnkrc

SCOPe Domain Coordinates for d2ybrf_:

Click to download the PDB-style file with coordinates for d2ybrf_.
(The format of our PDB-style files is described here.)

Timeline for d2ybrf_: