Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc2b [TaxId:9606] [102840] (4 PDB entries) E2-17 kDa |
Domain d2ybfa_: 2ybf A: [170723] automated match to d1jasa_ complexed with bme, na, so4 |
PDB Entry: 2ybf (more details), 2 Å
SCOPe Domain Sequences for d2ybfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ybfa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc2b [TaxId: 9606]} tparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefsee ypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpnspa nsqaaqlyqenkreyekrvsaiveqswnds
Timeline for d2ybfa_: