Lineage for d2ybfa_ (2ybf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407030Species Human (Homo sapiens), ubc2b [TaxId:9606] [102840] (3 PDB entries)
    E2-17 kDa
  8. 1407032Domain d2ybfa_: 2ybf A: [170723]
    automated match to d1jasa_
    complexed with bme, na, so4

Details for d2ybfa_

PDB Entry: 2ybf (more details), 2 Å

PDB Description: complex of rad18 (rad6 binding domain) with rad6b
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 b

SCOPe Domain Sequences for d2ybfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybfa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc2b [TaxId: 9606]}
tparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefsee
ypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpnspa
nsqaaqlyqenkreyekrvsaiveqswnds

SCOPe Domain Coordinates for d2ybfa_:

Click to download the PDB-style file with coordinates for d2ybfa_.
(The format of our PDB-style files is described here.)

Timeline for d2ybfa_: