Lineage for d1dw9h1 (1dw9 H:1-86)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537344Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
    probably does not bind to DNA
  6. 537345Protein Cyanase N-terminal domain [47436] (1 species)
  7. 537346Species Escherichia coli [TaxId:562] [47437] (2 PDB entries)
  8. 537364Domain d1dw9h1: 1dw9 H:1-86 [17072]
    Other proteins in same PDB: d1dw9a2, d1dw9b2, d1dw9c2, d1dw9d2, d1dw9e2, d1dw9f2, d1dw9g2, d1dw9h2, d1dw9i2, d1dw9j2

Details for d1dw9h1

PDB Entry: 1dw9 (more details), 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site

SCOP Domain Sequences for d1dw9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw9h1 a.35.1.4 (H:1-86) Cyanase N-terminal domain {Escherichia coli}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOP Domain Coordinates for d1dw9h1:

Click to download the PDB-style file with coordinates for d1dw9h1.
(The format of our PDB-style files is described here.)

Timeline for d1dw9h1: