Lineage for d2yb0d_ (2yb0 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349438Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2349439Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2349530Family a.204.1.0: automated matches [191410] (1 protein)
    not a true family
  6. 2349531Protein automated matches [190562] (4 species)
    not a true protein
  7. 2349537Species Leishmania major [TaxId:5664] [187550] (4 PDB entries)
  8. 2349541Domain d2yb0d_: 2yb0 D: [170718]
    automated match to d1ogla_
    complexed with dur, so4

Details for d2yb0d_

PDB Entry: 2yb0 (more details), 2.28 Å

PDB Description: the crystal structure of leishmania major dutpase in complex deoxyuridine
PDB Compounds: (D:) dutpase

SCOPe Domain Sequences for d2yb0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yb0d_ a.204.1.0 (D:) automated matches {Leishmania major [TaxId: 5664]}
nipgailhslaelqdglnamidpswravrsldnwalaitmestelldsypwkwwknlnat
pdlanvrielvdifhfslsgamqmrstpddeipaaslkplkevmttflpakectsdpygf
vffpltdtqnaiasfrniiqlanayrfdviieciiyaaedlgfnlvayyiakhtlncirq
lsgykdgsyvkvnngvednsllhncikdvsldevldadkyvqawnsimanvyeafqikes
drkdaerwfalaken

SCOPe Domain Coordinates for d2yb0d_:

Click to download the PDB-style file with coordinates for d2yb0d_.
(The format of our PDB-style files is described here.)

Timeline for d2yb0d_: