Class a: All alpha proteins [46456] (290 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
Protein automated matches [190562] (4 species) not a true protein |
Species Leishmania major [TaxId:5664] [187550] (4 PDB entries) |
Domain d2yb0a_: 2yb0 A: [170716] automated match to d1ogla_ complexed with dur, so4 |
PDB Entry: 2yb0 (more details), 2.28 Å
SCOPe Domain Sequences for d2yb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yb0a_ a.204.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} anipgailhslaelqdglnamidpswravrsldnwalaitmestelldsypwkwwknlna tpdlanvrielvdifhfslsgamqmrstpddeipaaslkplkevmttflpakectsdpyg fvffpltdtqnaiasfrniiqlanayrfdviieciiyaaedlgfnlvayyiakhtlncir qlsgykdgsyvkvnngvednsllhncikdvsldevldadkyvqawnsimanvyeafqike sdrkdaerwfalakenrl
Timeline for d2yb0a_: