SCOPe 2.01: Domain d2yazd_: 2yaz D:

Lineage for d2yazd_ (2yaz D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (3 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [187550] (4 PDB entries)

8. Domain d2yazd_: 2yaz D: [170714]
   automated match to d1ogla_
   complexed with mg, so4, ump

Details for d2yazd_

PDB Entry: 2yaz, 2.4 Å

PDB Description: the crystal structure of leishmania major dutpase in complex dump

PDB Compounds: (D:) dutpase

SCOPe Domain Sequences for d2yazd_:

Sequence; same for both SEQRES and ATOM records:

>d2yazd_ a.204.1.0 (D:) automated matches {Leishmania major [TaxId: 5664]}
nipgailhslaelqdglnamidpswravrsldnwalaitmestelldsypwkwwknlnat
pdlanvrielvdifhfslsgamqmrstpddeipaaslkplkevmttflpakectsdpygf
vffpltdtqnaiasfrniiqlanayrfdviieciiyaaedlgfnlvayyiakhtlncirq
lsgykdgsyvkvnngvednsllhncikdvsldevldadkyvqawnsimanvyeafqikes
drkdaerwfalakenrl

Timeline for d2yazd_:

• d2yazd_ is new in SCOPe 2.01-stable
  
• d2yazd_ appears in SCOPe 2.02
  
• d2yazd_ appears in the current release, SCOPe 2.08