| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
| Protein automated matches [190562] (4 species) not a true protein |
| Species Leishmania major [TaxId:5664] [187550] (4 PDB entries) |
| Domain d2yazd_: 2yaz D: [170714] automated match to d1ogla_ complexed with mg, so4, ump |
PDB Entry: 2yaz (more details), 2.4 Å
SCOPe Domain Sequences for d2yazd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yazd_ a.204.1.0 (D:) automated matches {Leishmania major [TaxId: 5664]}
nipgailhslaelqdglnamidpswravrsldnwalaitmestelldsypwkwwknlnat
pdlanvrielvdifhfslsgamqmrstpddeipaaslkplkevmttflpakectsdpygf
vffpltdtqnaiasfrniiqlanayrfdviieciiyaaedlgfnlvayyiakhtlncirq
lsgykdgsyvkvnngvednsllhncikdvsldevldadkyvqawnsimanvyeafqikes
drkdaerwfalakenrl
Timeline for d2yazd_: