Lineage for d2yanb1 (2yan B:232-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876477Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)
  8. 2876485Domain d2yanb1: 2yan B:232-334 [170709]
    Other proteins in same PDB: d2yana2, d2yanb2
    automated match to d1wika_
    complexed with cl, edo, fe, gsh, so4

Details for d2yanb1

PDB Entry: 2yan (more details), 1.9 Å

PDB Description: crystal structure of the second glutaredoxin domain of human txnl2
PDB Compounds: (B:) glutaredoxin-3

SCOPe Domain Sequences for d2yanb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yanb1 c.47.1.1 (B:232-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeevrq
glkaysnwptypqlyvkgelvggldivkelkengellpilrge

SCOPe Domain Coordinates for d2yanb1:

Click to download the PDB-style file with coordinates for d2yanb1.
(The format of our PDB-style files is described here.)

Timeline for d2yanb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yanb2