Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries) |
Domain d2yana_: 2yan A: [170708] automated match to d1wika_ complexed with cl, edo, fe, gsh, so4 |
PDB Entry: 2yan (more details), 1.9 Å
SCOPe Domain Sequences for d2yana_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yana_ c.47.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge
Timeline for d2yana_: