SCOPe 2.05: Domain d2yana_: 2yan A:

Lineage for d2yana_ (2yan A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)

8. Domain d2yana_: 2yan A: [170708]
   automated match to d1wika_
   complexed with cl, edo, fe, gsh, so4

Details for d2yana_

PDB Entry: 2yan, 1.9 Å

PDB Description: crystal structure of the second glutaredoxin domain of human txnl2

PDB Compounds: (A:) glutaredoxin-3

SCOPe Domain Sequences for d2yana_:

Sequence; same for both SEQRES and ATOM records:

>d2yana_ c.47.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev
rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge

Timeline for d2yana_:

• d2yana_ first appeared in SCOPe 2.01
  
• d2yana_ appears in SCOPe 2.04
  
• d2yana_ is called d2yana1 in SCOPe 2.06
  
• d2yana_ appears in the current release, SCOPe 2.08, called d2yana1