SCOPe 2.06: Domain d2ya3a1: 2ya3 A:396-544

Lineage for d2ya3a1 (2ya3 A:396-544)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (3 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
   PfamB PB166430

6. Protein automated matches [190788] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)

8. Domain d2ya3a1: 2ya3 A:396-544 [170705]
   Other proteins in same PDB: d2ya3a2, d2ya3a3, d2ya3b_, d2ya3e1, d2ya3e2
   automated match to d2v8qa1
   complexed with amp, j7v

Details for d2ya3a1

PDB Entry: 2ya3, 2.5 Å

PDB Description: structure of the regulatory fragment of mammalian ampk in complex with coumarin adp

PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2ya3a1:

Sequence, based on SEQRES records:

>d2ya3a1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlik

Sequence, based on observed residues (ATOM records):

>d2ya3a1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlik

Timeline for d2ya3a1:

• d2ya3a1 first appeared in SCOPe 2.01, called d2ya3a_
  
• d2ya3a1 was called d2ya3a_ in SCOPe 2.05
  
• d2ya3a1 appears in SCOPe 2.07
  
• d2ya3a1 appears in the current release, SCOPe 2.08