Lineage for d2ya3a_ (2ya3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040830Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 1040839Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1040861Protein automated matches [190788] (2 species)
    not a true protein
  7. 1040862Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)
  8. 1040864Domain d2ya3a_: 2ya3 A: [170705]
    Other proteins in same PDB: d2ya3b_
    automated match to d2v8qa1
    complexed with amp, j7v

Details for d2ya3a_

PDB Entry: 2ya3 (more details), 2.5 Å

PDB Description: structure of the regulatory fragment of mammalian ampk in complex with coumarin adp
PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2ya3a_:

Sequence, based on SEQRES records: (download)

>d2ya3a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyq
vdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltss
vtsldsspvdvaprpgshtieffemcanliknsctv

Sequence, based on observed residues (ATOM records): (download)

>d2ya3a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyq
vdsrtylldfrsiddevaprpgshtieffemcanliknsctv

SCOPe Domain Coordinates for d2ya3a_:

Click to download the PDB-style file with coordinates for d2ya3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ya3a_: