Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.6: KA1-like [103243] (2 families) contains a single copy of this fold |
Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
Protein automated matches [190788] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries) |
Domain d2ya3a_: 2ya3 A: [170705] Other proteins in same PDB: d2ya3b_ automated match to d2v8qa1 complexed with amp, j7v |
PDB Entry: 2ya3 (more details), 2.5 Å
SCOPe Domain Sequences for d2ya3a_:
Sequence, based on SEQRES records: (download)
>d2ya3a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyq vdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltss vtsldsspvdvaprpgshtieffemcanliknsctv
>d2ya3a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyq vdsrtylldfrsiddevaprpgshtieffemcanliknsctv
Timeline for d2ya3a_: