Lineage for d2ya3a1 (2ya3 A:396-544)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976205Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2976214Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2976236Protein automated matches [190788] (2 species)
    not a true protein
  7. 2976241Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)
  8. 2976243Domain d2ya3a1: 2ya3 A:396-544 [170705]
    Other proteins in same PDB: d2ya3a2, d2ya3a3, d2ya3b_, d2ya3e1, d2ya3e2
    automated match to d2v8qa1
    complexed with amp, j7v

Details for d2ya3a1

PDB Entry: 2ya3 (more details), 2.5 Å

PDB Description: structure of the regulatory fragment of mammalian ampk in complex with coumarin adp
PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2ya3a1:

Sequence, based on SEQRES records: (download)

>d2ya3a1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlik

Sequence, based on observed residues (ATOM records): (download)

>d2ya3a1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlik

SCOPe Domain Coordinates for d2ya3a1:

Click to download the PDB-style file with coordinates for d2ya3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ya3a1: