Lineage for d2y8qb_ (2y8q B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011443Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 3011444Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 3011445Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 3011459Protein automated matches [190789] (2 species)
    not a true protein
  7. 3011469Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries)
  8. 3011473Domain d2y8qb_: 2y8q B: [170700]
    Other proteins in same PDB: d2y8qa1, d2y8qa2, d2y8qa3, d2y8qe1, d2y8qe2
    automated match to d2v8qb1
    complexed with adp, amp

Details for d2y8qb_

PDB Entry: 2y8q (more details), 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2y8qb_:

Sequence, based on SEQRES records: (download)

>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records): (download)

>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdpnhvmlnhlyalsikdsvmvlsathrykk
kyvttllykpi

SCOPe Domain Coordinates for d2y8qb_:

Click to download the PDB-style file with coordinates for d2y8qb_.
(The format of our PDB-style files is described here.)

Timeline for d2y8qb_: