Lineage for d2y8lb_ (2y8l B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243186Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 2243187Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 2243188Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 2243202Protein automated matches [190789] (2 species)
    not a true protein
  7. 2243212Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries)
  8. 2243217Domain d2y8lb_: 2y8l B: [170698]
    Other proteins in same PDB: d2y8la1, d2y8la2, d2y8la3, d2y8le1, d2y8le2
    automated match to d2v8qb1
    complexed with adp, amp

Details for d2y8lb_

PDB Entry: 2y8l (more details), 2.5 Å

PDB Description: Structure of an active form of mammalian AMPK in complex with two ADP
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2y8lb_:

Sequence, based on SEQRES records: (download)

>d2y8lb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records): (download)

>d2y8lb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnpnhvmlnhlyalsikdsvmvlsathrykkky
vttllykpi

SCOPe Domain Coordinates for d2y8lb_:

Click to download the PDB-style file with coordinates for d2y8lb_.
(The format of our PDB-style files is described here.)

Timeline for d2y8lb_: