SCOPe 2.08: Domain d2y8lb_: 2y8l B:

Lineage for d2y8lb_ (2y8l B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)
   automatically mapped to Pfam PF04739

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein automated matches [190789] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries)

8. Domain d2y8lb_: 2y8l B: [170698]
   Other proteins in same PDB: d2y8la1, d2y8la2, d2y8la3, d2y8le1, d2y8le2
   automated match to d2v8qb1
   complexed with adp, amp

Details for d2y8lb_

PDB Entry: 2y8l, 2.5 Å

PDB Description: Structure of an active form of mammalian AMPK in complex with two ADP

PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2y8lb_:

Sequence, based on SEQRES records:

>d2y8lb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records):

>d2y8lb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnpnhvmlnhlyalsikdsvmvlsathrykkky
vttllykpi

Timeline for d2y8lb_:

• d2y8lb_ first appeared in SCOPe 2.01
  
• d2y8lb_ appears in SCOPe 2.07