Lineage for d2y8la_ (2y8l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926865Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 1926874Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1926896Protein automated matches [190788] (2 species)
    not a true protein
  7. 1926901Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)
  8. 1926906Domain d2y8la_: 2y8l A: [170697]
    Other proteins in same PDB: d2y8lb_, d2y8le1, d2y8le2
    automated match to d2v8qa1
    complexed with adp, amp

Details for d2y8la_

PDB Entry: 2y8l (more details), 2.5 Å

PDB Description: Structure of an active form of mammalian AMPK in complex with two ADP
PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2y8la_:

Sequence, based on SEQRES records: (download)

>d2y8la_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevslts
svtsldsspvdvaprpgshtieffemcanliknsctvn

Sequence, based on observed residues (ATOM records): (download)

>d2y8la_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddevaprpgshtieffemcanliknsctvn

SCOPe Domain Coordinates for d2y8la_:

Click to download the PDB-style file with coordinates for d2y8la_.
(The format of our PDB-style files is described here.)

Timeline for d2y8la_: