![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.6: KA1-like [103243] (3 families) ![]() contains a single copy of this fold |
![]() | Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
![]() | Protein automated matches [190788] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries) |
![]() | Domain d2y8la_: 2y8l A: [170697] Other proteins in same PDB: d2y8lb_, d2y8le1, d2y8le2 automated match to d2v8qa1 complexed with adp, amp |
PDB Entry: 2y8l (more details), 2.5 Å
SCOPe Domain Sequences for d2y8la_:
Sequence, based on SEQRES records: (download)
>d2y8la_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly qvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevslts svtsldsspvdvaprpgshtieffemcanliknsctvn
>d2y8la_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly qvdsrtylldfrsiddevaprpgshtieffemcanliknsctvn
Timeline for d2y8la_: