Lineage for d2y8ga_ (2y8g A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957545Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 957566Protein automated matches [191227] (1 species)
    not a true protein
  7. 957567Species Human (Homo sapiens) [TaxId:9606] [189645] (2 PDB entries)
  8. 957568Domain d2y8ga_: 2y8g A: [170695]
    automated match to d2crfa1
    complexed with so4; mutant

Details for d2y8ga_

PDB Entry: 2y8g (more details), 1.61 Å

PDB Description: structure of the ran-binding domain from human ranbp3 (e352a-r353v double mutant)
PDB Compounds: (A:) ran-binding protein 3

SCOPe Domain Sequences for d2y8ga_:

Sequence, based on SEQRES records: (download)

>d2y8ga_ b.55.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esnvlqmqcklfvfdktsqswvavgrgllrlndmastddgtlqsrlvmrtqgslrlilnt
klwaqmqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrsrveq
eqeak

Sequence, based on observed residues (ATOM records): (download)

>d2y8ga_ b.55.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esnvlqmqcklfvfdktsqswvavgrgllrlndmastddgtlqsrlvmrtqgslrlilnt
klwaqmqidkaseksiritamddqgvkvflisasskdtgqlyaalhhrilalrsrveqeq
eak

SCOPe Domain Coordinates for d2y8ga_:

Click to download the PDB-style file with coordinates for d2y8ga_.
(The format of our PDB-style files is described here.)

Timeline for d2y8ga_: