Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189700] (1 PDB entry) |
Domain d2y8eb_: 2y8e B: [170690] automated match to d1yzqa1 complexed with gnp, mg, so4 |
PDB Entry: 2y8e (more details), 1.39 Å
SCOPe Domain Sequences for d2y8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y8eb_ c.37.1.8 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlw dtagqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdviimlvgnk tdlsdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaal
Timeline for d2y8eb_: