Lineage for d2y8eb_ (2y8e B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476237Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189700] (1 PDB entry)
  8. 2476239Domain d2y8eb_: 2y8e B: [170690]
    automated match to d1yzqa1
    complexed with gnp, mg, so4

Details for d2y8eb_

PDB Entry: 2y8e (more details), 1.39 Å

PDB Description: crystal structure of d. melanogaster rab6 gtpase bound to gmppnp
PDB Compounds: (B:) rab-protein 6

SCOPe Domain Sequences for d2y8eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y8eb_ c.37.1.8 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlw
dtagqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdviimlvgnk
tdlsdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaal

SCOPe Domain Coordinates for d2y8eb_:

Click to download the PDB-style file with coordinates for d2y8eb_.
(The format of our PDB-style files is described here.)

Timeline for d2y8eb_: