SCOPe 2.02: Domain d2y7rh_: 2y7r H:

Lineage for d2y7rh_ (2y7r H:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (9 species)
   not a true protein

7. Species Burkholderia sp. [TaxId:233098] [190010] (3 PDB entries)

8. Domain d2y7rh_: 2y7r H: [170677]
   automated match to d1utba_

Details for d2y7rh_

PDB Entry: 2y7r, 2.99 Å

PDB Description: dntr inducer binding domain

PDB Compounds: (H:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7rh_:

Sequence; same for both SEQRES and ATOM records:

>d2y7rh_ c.94.1.1 (H:) automated matches {Burkholderia sp. [TaxId: 233098]}
mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghgev
dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
diainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d2y7rh_:

• d2y7rh_ first appeared in SCOPe 2.01
  
• d2y7rh_ appears in SCOPe 2.03
  
• d2y7rh_ appears in the current release, SCOPe 2.08