| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
| Protein automated matches [190140] (9 species) not a true protein |
| Species Burkholderia sp. [TaxId:233098] [190010] (3 PDB entries) |
| Domain d2y7rg_: 2y7r G: [170676] automated match to d1utba_ |
PDB Entry: 2y7r (more details), 2.99 Å
SCOPe Domain Sequences for d2y7rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y7rg_ c.94.1.1 (G:) automated matches {Burkholderia sp. [TaxId: 233098]}
mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghgev
dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
diainlfwhakynrdpgnmwlrqlfvelfse
Timeline for d2y7rg_: