Lineage for d2y7re_ (2y7r E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009307Species Burkholderia sp. [TaxId:233098] [190010] (1 PDB entry)
  8. 1009312Domain d2y7re_: 2y7r E: [170674]
    automated match to d1utba_

Details for d2y7re_

PDB Entry: 2y7r (more details), 2.99 Å

PDB Description: dntr inducer binding domain
PDB Compounds: (E:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y7re_ c.94.1.1 (E:) automated matches {Burkholderia sp. [TaxId: 233098]}
mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghgev
dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
diainlfwhakynrdpgnmwlrqlfvelfsea

SCOPe Domain Coordinates for d2y7re_:

Click to download the PDB-style file with coordinates for d2y7re_.
(The format of our PDB-style files is described here.)

Timeline for d2y7re_: