Lineage for d2y7ib_ (2y7i B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1186385Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1186386Protein automated matches [190039] (34 species)
    not a true protein
  7. 1186487Species Salmonella typhimurium [TaxId:90371] [189953] (1 PDB entry)
  8. 1186489Domain d2y7ib_: 2y7i B: [170669]
    automated match to d1lafe_
    complexed with act, arg, gol, zn

Details for d2y7ib_

PDB Entry: 2y7i (more details), 1.9 Å

PDB Description: structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
PDB Compounds: (B:) stm4351

SCOPe Domain Sequences for d2y7ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y7ib_ c.94.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
artlhfgtsatyapyefvdadnkivgfdidvanavckemqaecsftnqsfdslipslrfk
kfdaviagmdmtpkreqqvsfsqpyyeglsavvvtrkgayhtfadlkgkkvglengtthq
rylqdkqqaitpvaydsylnaftdlknnrlegvfgdvaaigkwlknnpdyaimderasdp
dyygkglgiavrkdndallqeinaaldkvkaspeyaqmqekwft

SCOPe Domain Coordinates for d2y7ib_:

Click to download the PDB-style file with coordinates for d2y7ib_.
(The format of our PDB-style files is described here.)

Timeline for d2y7ib_: