SCOPe 2.01: Domain d2y7ib_: 2y7i B:

Lineage for d2y7ib_ (2y7i B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (20 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189953] (1 PDB entry)

8. Domain d2y7ib_: 2y7i B: [170669]
   automated match to d1lafe_
   complexed with act, arg, gol, zn

Details for d2y7ib_

PDB Entry: 2y7i, 1.9 Å

PDB Description: structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.

PDB Compounds: (B:) stm4351

SCOPe Domain Sequences for d2y7ib_:

Sequence; same for both SEQRES and ATOM records:

>d2y7ib_ c.94.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
artlhfgtsatyapyefvdadnkivgfdidvanavckemqaecsftnqsfdslipslrfk
kfdaviagmdmtpkreqqvsfsqpyyeglsavvvtrkgayhtfadlkgkkvglengtthq
rylqdkqqaitpvaydsylnaftdlknnrlegvfgdvaaigkwlknnpdyaimderasdp
dyygkglgiavrkdndallqeinaaldkvkaspeyaqmqekwft

Timeline for d2y7ib_:

• d2y7ib_ is new in SCOPe 2.01-stable
  
• d2y7ib_ appears in SCOPe 2.02
  
• d2y7ib_ appears in the current release, SCOPe 2.08