Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (20 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189953] (1 PDB entry) |
Domain d2y7ib_: 2y7i B: [170669] automated match to d1lafe_ complexed with act, arg, gol, zn |
PDB Entry: 2y7i (more details), 1.9 Å
SCOPe Domain Sequences for d2y7ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y7ib_ c.94.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} artlhfgtsatyapyefvdadnkivgfdidvanavckemqaecsftnqsfdslipslrfk kfdaviagmdmtpkreqqvsfsqpyyeglsavvvtrkgayhtfadlkgkkvglengtthq rylqdkqqaitpvaydsylnaftdlknnrlegvfgdvaaigkwlknnpdyaimderasdp dyygkglgiavrkdndallqeinaaldkvkaspeyaqmqekwft
Timeline for d2y7ib_: