Lineage for d2y77a_ (2y77 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983552Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 983553Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
  6. 983554Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 983607Species Mycobacterium tuberculosis [TaxId:1773] [52307] (8 PDB entries)
  8. 983610Domain d2y77a_: 2y77 A: [170667]
    automated match to d1h05a_
    complexed with cb8, so4

Details for d2y77a_

PDB Entry: 2y77 (more details), 1.5 Å

PDB Description: structure of mycobacterium tuberculosis type ii dehydroquinase complexed with (1r,4s,5r)-3-(benzo(b)thiophen-2-ylmethoxy)-1,4,5- trihydroxy-2-(thiophen-2-ylmethyl)cyclohex-2-enecarboxylate
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2y77a_:

Sequence, based on SEQRES records: (download)

>d2y77a_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

Sequence, based on observed residues (ATOM records): (download)

>d2y77a_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrgtthdelvaliereaaelglkavvrqsdseaqlldwihqaadaa
epvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivglg
iqgyllalrylaeh

SCOPe Domain Coordinates for d2y77a_:

Click to download the PDB-style file with coordinates for d2y77a_.
(The format of our PDB-style files is described here.)

Timeline for d2y77a_: