Lineage for d2y71a_ (2y71 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857823Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2857870Species Mycobacterium tuberculosis [TaxId:1773] [52307] (16 PDB entries)
  8. 2857874Domain d2y71a_: 2y71 A: [170665]
    automated match to d1h05a_
    complexed with cb6, na, so4

Details for d2y71a_

PDB Entry: 2y71 (more details), 1.5 Å

PDB Description: structure of mycobacterium tuberculosis type ii dehydroquinase complexed with (1r,4s,5r)-1,4,5-trihydroxy-3-((5-methylbenzo(b) thiophen-2-yl)methoxy)cyclohex-2-enecarboxylate
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2y71a_:

Sequence, based on SEQRES records: (download)

>d2y71a_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

Sequence, based on observed residues (ATOM records): (download)

>d2y71a_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgpavyggtthdelvaliereaaelglkavvrqsdseaqlldwihqa
adaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvi
vglgiqgyllalrylaeh

SCOPe Domain Coordinates for d2y71a_:

Click to download the PDB-style file with coordinates for d2y71a_.
(The format of our PDB-style files is described here.)

Timeline for d2y71a_: