SCOPe 2.05: Domain d2y70b_: 2y70 B:

Lineage for d2y70b_ (2y70 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)

8. Domain d2y70b_: 2y70 B: [170662]
   automated match to d1mssa_
   complexed with act, so4; mutant

Details for d2y70b_

PDB Entry: 2y70, 2.3 Å

PDB Description: crystallographic structure of gm23, mutant g89d, an example of catalytic migration from tim to thiamin phosphate synthase.

PDB Compounds: (B:) triose-phosphate isomerase

SCOPe Domain Sequences for d2y70b_:

Sequence; same for both SEQRES and ATOM records:

>d2y70b_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapswymgaqamtkerlshp
kfviaaqnagnadalaslkdfgiswivldhserrayygetneivadkvaaavasgfmvia
cigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigtgkvatpqqaqe
ahalirswvsskvgadvagelrilyggsvngrnartlyqqrdvngflvggaslkpefvdi
ikate

Timeline for d2y70b_:

• d2y70b_ first appeared in SCOPe 2.01
  
• d2y70b_ appears in SCOPe 2.04
  
• d2y70b_ appears in SCOPe 2.06
  
• d2y70b_ appears in the current release, SCOPe 2.08