Lineage for d2y6tg_ (2y6t G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773996Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2773997Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2773998Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. 2774026Protein automated matches [191287] (2 species)
    not a true protein
  7. 2774032Species Yersinia pseudotuberculosis [TaxId:502800] [189934] (1 PDB entry)
  8. 2774035Domain d2y6tg_: 2y6t G: [170658]
    Other proteins in same PDB: d2y6ta_, d2y6tb_, d2y6tc_, d2y6td_
    automated match to d1ecya_
    complexed with so4

Details for d2y6tg_

PDB Entry: 2y6t (more details), 2.74 Å

PDB Description: molecular recognition of chymotrypsin by the serine protease inhibitor ecotin from yersinia pestis
PDB Compounds: (G:) ecotin

SCOPe Domain Sequences for d2y6tg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y6tg_ b.16.1.1 (G:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
qqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnletrt
lsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvpqg
vevkyriweagedirsaqvk

SCOPe Domain Coordinates for d2y6tg_:

Click to download the PDB-style file with coordinates for d2y6tg_.
(The format of our PDB-style files is described here.)

Timeline for d2y6tg_: